PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2035015 to PF06476 (DUF1090)

VIMSS2035015 has 124 amino acids

Query:       DUF1090  [M=110]
Accession:   PF06476.17
Description: Protein of unknown function (DUF1090)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.3e-39  119.6   9.3    3.9e-39  119.4   9.3    1.1  1  VIMSS2035015  


Domain annotation for each sequence (and alignments):
>> VIMSS2035015  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  119.4   9.3   3.9e-39   3.9e-39       4     108 ..       4     108 ..       1     110 [. 0.96

  Alignments for each domain:
  == domain 1  score: 119.4 bits;  conditional E-value: 3.9e-39
       DUF1090   4 lsllaaaaaaalsgCaaKaqaiekqlseAkahgnkarvagLekALaevkahCtdaglleereakveekeeeVaereaeLkeakekgdadkiakrkkk 100
                   l l+ +a+ +++ gC+a++qa+++ql +Akah+n+++vagLe+AL+++++hCtdagl++e++++v+e +e+V+er  eL++a+ +g++dkiak+++k
  VIMSS2035015   4 LLLAGQAYGSEAVGCKARQQAVKEQLVFAKAHDNADQVAGLERALRNIETHCTDAGLFKEQQQRVAELKEQVNERLVELQNARVTGKPDKIAKKQAK 100
                   5667788999*************************************************************************************** PP

       DUF1090 101 LaeareeL 108
                   L+ea+++L
  VIMSS2035015 101 LEEAQTKL 108
                   ******99 PP



Or compare VIMSS2035015 to CDD or PaperBLAST