VIMSS2056913 has 76 amino acids
Query: DUF2525 [M=60]
Accession: PF10733.13
Description: Protein of unknown function (DUF2525)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.3e-39 118.2 2.1 8.1e-39 117.9 2.1 1.1 1 VIMSS2056913
Domain annotation for each sequence (and alignments):
>> VIMSS2056913
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 117.9 2.1 8.1e-39 8.1e-39 1 60 [] 19 76 .] 19 76 .] 0.99
Alignments for each domain:
== domain 1 score: 117.9 bits; conditional E-value: 8.1e-39
DUF2525 1 dVDALLaAineitesevqeaisaddaqrvtvdGreyhtytELAeAfELDIrDFsvsEvNR 60
dVDALLaAinei+esev++ s++d+++v+vdGreyht++ELA+AfELDI+DFsvsEvNR
VIMSS2056913 19 DVDALLAAINEISESEVHR--SQNDSEHVSVDGREYHTWRELADAFELDIHDFSVSEVNR 76
9******************..**************************************9 PP
Or compare VIMSS2056913 to CDD or PaperBLAST