VIMSS2060802 has 87 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-23 69.6 1.7 1.4e-23 69.4 1.7 1.0 1 VIMSS2060802
Domain annotation for each sequence (and alignments):
>> VIMSS2060802
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 69.4 1.7 1.4e-23 1.4e-23 1 79 [] 7 84 .. 7 84 .. 0.96
Alignments for each domain:
== domain 1 score: 69.4 bits; conditional E-value: 1.4e-23
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R+eId++D+ ++ Ll++Rm+l++++ ++Kk +g +vld +Re+ +++r++++ e++ ++e+v + f +i++ sr++Q+
VIMSS2060802 7 RQEIDQVDDAIVTLLEQRMNLVDQVVALKKLTGTAVLDSKREDVIFARVADK-VENKDYKETVVATFSDILKRSREFQN 84
9**************************************************5.4788999****************995 PP
Or compare VIMSS2060802 to CDD or PaperBLAST