VIMSS2092466 has 200 amino acids
Query: DUF1949 [M=56] Accession: PF09186.15 Description: Domain of unknown function (DUF1949) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.7e-11 27.9 0.1 1.4e-10 27.3 0.1 1.3 1 VIMSS2092466 Domain annotation for each sequence (and alignments): >> VIMSS2092466 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.3 0.1 1.4e-10 1.4e-10 1 56 [] 139 194 .. 139 194 .. 0.97 Alignments for each domain: == domain 1 score: 27.3 bits; conditional E-value: 1.4e-10 DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56 l+ dY+ +++l +g++i e+Y+d++ ++ + +++ + f +++ ++t G+ VIMSS2092466 139 LEYDYSETVNVENLANRYGIQIIKENYSDNISKIIKIVASDKDMFLEEIKNITKGK 194 5789**************************************************97 PP
Or compare VIMSS2092466 to CDD or PaperBLAST