VIMSS2092908 has 94 amino acids
Query: DUF493 [M=84]
Accession: PF04359.18
Description: Protein of unknown function (DUF493)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-30 91.6 0.2 2.2e-30 91.4 0.2 1.0 1 VIMSS2092908
Domain annotation for each sequence (and alignments):
>> VIMSS2092908
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 91.4 0.2 2.2e-30 2.2e-30 2 84 .] 12 94 .] 11 94 .] 0.98
Alignments for each domain:
== domain 1 score: 91.4 bits; conditional E-value: 2.2e-30
DUF493 2 elleFPcdfpikviGkaeeefeeavvevverhapefdpeevevrpSskgkYvSvtvtvtveskeqldaiyraLkahervkmvL 84
+ +eFPc+fpik++++ ++e +e +++v+e+ +p+ ++ +++++S++gkY+S+t+ +t++skeqld+iy++++ah++v+mvL
VIMSS2092908 12 TFFEFPCQFPIKIMANPQKETVEFILSVFEKYVPNHSEIDFNTKESKTGKYISITAIFTADSKEQLDNIYKEISAHPEVHMVL 94
679*******************************************************************************8 PP
Or compare VIMSS2092908 to CDD or PaperBLAST