VIMSS209398 has 391 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.2e-23 67.3 0.0 1.1e-22 66.6 0.0 1.4 1 VIMSS209398
Domain annotation for each sequence (and alignments):
>> VIMSS209398
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.6 0.0 1.1e-22 1.1e-22 1 78 [. 22 98 .. 22 99 .. 0.94
Alignments for each domain:
== domain 1 score: 66.6 bits; conditional E-value: 1.1e-22
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R Id +Dr+ll+Ll++R++l+ e++++K++ v++p Re+ev+++l++ a+e l++e +++i+reiis sr+lQ
VIMSS209398 22 RVTIDGLDRDLLALLNRRAALSLEVGRIKATDPGIVFRPFREREVFDNLEA-ANEGPLPDEHLRAIWREIISSSRSLQ 98
778**************************988889****************.56777********************9 PP
Or compare VIMSS209398 to CDD or PaperBLAST