VIMSS209400 has 255 amino acids
Query: PDH_N [M=154]
Accession: PF02153.21
Description: Prephenate dehydrogenase, nucleotide-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-21 62.0 0.3 3.8e-21 61.4 0.3 1.3 1 VIMSS209400
Domain annotation for each sequence (and alignments):
>> VIMSS209400
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.4 0.3 3.8e-21 3.8e-21 41 108 .. 41 107 .. 20 141 .. 0.87
Alignments for each domain:
== domain 1 score: 61.4 bits; conditional E-value: 3.8e-21
PDH_N 41 eavkeadivllavPvevilevlkelaphlkedalitDvgsvKekvvkelekllkgksfvgghPmaGte 108
av+ ad+v+l+vPvev++evl +ap l+++ ++ D++svK+++++ ++++ + +vg+hP++G++
VIMSS209400 41 PAVQGADVVILCVPVEVLAEVLSIVAPLLSPKQVLADITSVKVRPMEVMQAFHA-GPVVGTHPLFGPD 107
3899************************************************99.99*********94 PP
Or compare VIMSS209400 to CDD or PaperBLAST