VIMSS2101403 has 136 amino acids
Query: DUF732 [M=72]
Accession: PF05305.18
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-20 59.5 0.0 3.2e-20 58.7 0.0 1.3 1 VIMSS2101403
Domain annotation for each sequence (and alignments):
>> VIMSS2101403
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 58.7 0.0 3.2e-20 3.2e-20 2 72 .] 58 127 .. 56 127 .. 0.94
Alignments for each domain:
== domain 1 score: 58.7 bits; conditional E-value: 3.2e-20
DUF732 2 DdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCPq 72
D Fl L++ G+++t+pdaa+ G+ vC+ L G+++++v+ al++s+p l + a+++ ++i++yCP+
VIMSS2101403 58 DSVFLGNLHDRGISFTNPDAAVYNGKMVCTNLGGGMTVQQVVEALQSSSPALGDRTTAYVA-VSIRTYCPK 127
667*********************************************9999999996666.********5 PP
Or compare VIMSS2101403 to CDD or PaperBLAST