VIMSS215882 has 70 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-25 74.8 10.9 2.5e-25 74.6 10.9 1.0 1 VIMSS215882
Domain annotation for each sequence (and alignments):
>> VIMSS215882
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 74.6 10.9 2.5e-25 2.5e-25 1 56 [] 4 59 .. 4 59 .. 0.99
Alignments for each domain:
== domain 1 score: 74.6 bits; conditional E-value: 2.5e-25
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
E+d+ Gv++p+llv+++ ++l+l ++++l rl++yrlvWh+aLf++al+++llg+
VIMSS215882 4 ELDISGVFLPTLLVMMFGTYLLFLGVHAVLVRLHFYRLVWHRALFNVALYAVLLGA 59
89****************************************************96 PP
Or compare VIMSS215882 to CDD or PaperBLAST