VIMSS216820 has 91 amino acids
Query: DUF1145 [M=58] Accession: PF06611.16 Description: Protein of unknown function (DUF1145) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-24 72.1 6.3 1.4e-24 72.1 6.3 1.4 2 VIMSS216820 Domain annotation for each sequence (and alignments): >> VIMSS216820 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.1 6.3 1.4e-24 1.4e-24 2 58 .] 4 60 .. 3 60 .. 0.96 2 ? -2.5 0.1 0.28 0.28 31 39 .. 70 78 .. 65 81 .. 0.49 Alignments for each domain: == domain 1 score: 72.1 bits; conditional E-value: 1.4e-24 DUF1145 2 linlGkllmlvvWlvllvNliqPfpgplnillniagivlvlmHllqlllfkaalkkk 58 +++lGk+l++++W+v+l+N ++P p p+n+l+n agivl+++Hll++l+f+ +l+++ VIMSS216820 4 ILGLGKVLTVAFWGVVLFNQLMPQPLPFNLLINAAGIVLFGLHLLEVLFFNRSLRGR 60 789***************************************************975 PP == domain 2 score: -2.5 bits; conditional E-value: 0.28 DUF1145 31 illniagiv 39 ill + v VIMSS216820 70 ILLTGIFHV 78 444444333 PP
Or compare VIMSS216820 to CDD or PaperBLAST