PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2168263 to PF04025 (RemA-like)

VIMSS2168263 has 89 amino acids

Query:       RemA-like  [M=73]
Accession:   PF04025.18
Description: Extracellular matrix regulatory protein A-like
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    8.1e-43  130.8   0.5    9.7e-43  130.5   0.5    1.1  1  VIMSS2168263  


Domain annotation for each sequence (and alignments):
>> VIMSS2168263  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  130.5   0.5   9.7e-43   9.7e-43       1      73 []       5      77 ..       5      77 .. 0.99

  Alignments for each domain:
  == domain 1  score: 130.5 bits;  conditional E-value: 9.7e-43
     RemA-like  1 liniGfgnvVnadriiaivspesapikrliqeakeegklidaTqgrktrsviitdsghviLSalqpetlakRl 73
                  liniGfgn+V+a+r++aivspesapikr+iqea+++g+lidaT+gr+tr+viitds+hviLSa+qpet+a+Rl
  VIMSS2168263  5 LINIGFGNIVSANRLVAIVSPESAPIKRIIQEARDRGMLIDATYGRRTRAVIITDSDHVILSAVQPETVAHRL 77
                  8**********************************************************************97 PP



Or compare VIMSS2168263 to CDD or PaperBLAST