VIMSS216848 has 68 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-22 66.2 12.3 1.3e-22 65.9 12.3 1.1 1 VIMSS216848
Domain annotation for each sequence (and alignments):
>> VIMSS216848
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 65.9 12.3 1.3e-22 1.3e-22 1 56 [] 5 60 .. 5 60 .. 0.97
Alignments for each domain:
== domain 1 score: 65.9 bits; conditional E-value: 1.3e-22
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
E+++gGv+++p+l+++llAl+lt llr++ +++ l r++Wh aLfd+alfvc+l+l
VIMSS216848 5 EWEVGGVLLSPFLLYVLLALLLTGLLRLVVHATPLGRWIWHEALFDAALFVCVLFL 60
7899*************************************************976 PP
Or compare VIMSS216848 to CDD or PaperBLAST