PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS216961 to PF07869 (DUF1656)

VIMSS216961 has 66 amino acids

Query:       DUF1656  [M=56]
Accession:   PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.6e-23   68.9   6.0    1.9e-23   68.6   6.0    1.1  1  VIMSS216961  


Domain annotation for each sequence (and alignments):
>> VIMSS216961  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   68.6   6.0   1.9e-23   1.9e-23       1      56 []       4      59 ..       4      59 .. 0.99

  Alignments for each domain:
  == domain 1  score: 68.6 bits;  conditional E-value: 1.9e-23
      DUF1656  1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
                 Ei++ Gvy+p++ +++l Al l + l+r +a    yr++WhpaL++l+lfvcl+g+
  VIMSS216961  4 EIAFHGVYMPTMTLMFLFALGLAWGLDRFIASHDGYRFFWHPALLRLSLFVCLFGA 59
                 9*****************************************************96 PP



Or compare VIMSS216961 to CDD or PaperBLAST