VIMSS217855 has 232 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.3e-24 71.4 1.7 7.5e-24 70.3 1.7 1.7 1 VIMSS217855
Domain annotation for each sequence (and alignments):
>> VIMSS217855
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.3 1.7 7.5e-24 7.5e-24 1 78 [. 142 218 .. 142 219 .. 0.97
Alignments for each domain:
== domain 1 score: 70.3 bits; conditional E-value: 7.5e-24
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R++IdeiDr l+ Lla+R +l+ ++a +Kk+++ +v+ p+R+e+v++++re a+e g ++e+ve+++r++is+++a +
VIMSS217855 142 RQRIDEIDRSLVSLLAKRGRLVTQAAGFKKTTD-DVRAPARVEQVIKKAREMADETGASAEVVEQVYRAMISAFIAEE 218
9****************************8777.9***************************************9976 PP
Or compare VIMSS217855 to CDD or PaperBLAST