VIMSS218055 has 164 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-49 152.5 0.1 2e-49 152.2 0.1 1.1 1 VIMSS218055
Domain annotation for each sequence (and alignments):
>> VIMSS218055
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 152.2 0.1 2e-49 2e-49 1 107 [] 55 161 .. 55 161 .. 0.99
Alignments for each domain:
== domain 1 score: 152.2 bits; conditional E-value: 2e-49
DUF934 1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekalerfsvaYqa 98
gv+l+sd+++ee+ +d++++++ial+fp+FtDGR yS arlLR+r+++kgelrA+GdvlrDql++++rcGfdaf++r+dkd+e+a ++l++fsv+Yqa
VIMSS218055 55 GVWLDSDQEAEEIGEDVHHFQVIALNFPAFTDGRSYSNARLLRDRYKFKGELRAIGDVLRDQLFFMARCGFDAFAIRADKDPEDALQSLKDFSVTYQA 152
8************************************************************************************************* PP
DUF934 99 avdeeqplf 107
a+de+ plf
VIMSS218055 153 ATDEPLPLF 161
*******97 PP
Or compare VIMSS218055 to CDD or PaperBLAST