VIMSS218136 has 80 amino acids
Query: DUF1654 [M=70]
Accession: PF07867.15
Description: Protein of unknown function (DUF1654)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.2e-37 111.3 0.2 8e-37 111.2 0.2 1.0 1 VIMSS218136
Domain annotation for each sequence (and alignments):
>> VIMSS218136
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 111.2 0.2 8e-37 8e-37 1 70 [] 10 79 .. 10 79 .. 0.98
Alignments for each domain:
== domain 1 score: 111.2 bits; conditional E-value: 8e-37
DUF1654 1 tsyerlgaRvqriinaPaaQksrvavvlrlegeseedWarlleelaeteevelafqdDgsvrvrWerple 70
+sye+lg+R+q+iin+P+aQ+sr+a+++rle+es++dW+ ll+e+ae+++v+la +dDg+v+++W+ p+e
VIMSS218136 10 SSYEQLGVRIQKIINSPTAQRSRAALIFRLEQESPDDWETLLQEIAENDNVTLAHRDDGGVQIFWTIPKE 79
59****************************************************************9875 PP
Or compare VIMSS218136 to CDD or PaperBLAST