VIMSS218952 has 102 amino acids
Query: DUF485 [M=89]
Accession: PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.8e-36 108.3 0.0 8.7e-36 108.2 0.0 1.0 1 VIMSS218952
Domain annotation for each sequence (and alignments):
>> VIMSS218952
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 108.2 0.0 8.7e-36 8.7e-36 2 88 .. 11 97 .. 10 98 .. 0.98
Alignments for each domain:
== domain 1 score: 108.2 bits; conditional E-value: 8.7e-36
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeeir 88
++p+Fq+Lvr++rr+ lt+++lvvY++fvllvaf+p+ l++ ++ g++tvg+l+g+l+++l+f+ltg+Yv+rAn+ +Dpl+++++
VIMSS218952 11 NHPDFQHLVRRKRRLNGSLTLAMLVVYYGFVLLVAFSPSTLGQSLSGGVTTVGMLVGVLMVLLSFALTGIYVHRANNVLDPLNDKVK 97
79********************************************88************************************997 PP
Or compare VIMSS218952 to CDD or PaperBLAST