VIMSS219439 has 121 amino acids
Query: DUF1654 [M=70]
Accession: PF07867.15
Description: Protein of unknown function (DUF1654)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.8e-35 106.2 0.5 3.9e-35 105.8 0.5 1.2 1 VIMSS219439
Domain annotation for each sequence (and alignments):
>> VIMSS219439
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 105.8 0.5 3.9e-35 3.9e-35 1 69 [. 30 98 .. 30 99 .. 0.98
Alignments for each domain:
== domain 1 score: 105.8 bits; conditional E-value: 3.9e-35
DUF1654 1 tsyerlgaRvqriinaPaaQksrvavvlrlegeseedWarlleelaeteevelafqdDgsvrvrWerpl 69
t++erl++Rv+++in+P aQ++r++vv+rl++++e++W++++++l e++e++l+f+dD+sv+vrW+r++
VIMSS219439 30 TGIERLSLRVSSMINHPLAQTQRWVVVHRLDSDGEAEWEEVMGQLLEMPELQLTFNDDASVTVRWARSS 98
789***************************************************************986 PP
Or compare VIMSS219439 to CDD or PaperBLAST