VIMSS2195305 has 101 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-22 66.3 0.1 1.5e-22 66.1 0.1 1.0 1 VIMSS2195305
Domain annotation for each sequence (and alignments):
>> VIMSS2195305
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.1 0.1 1.5e-22 1.5e-22 1 78 [. 14 90 .. 14 91 .. 0.97
Alignments for each domain:
== domain 1 score: 66.1 bits; conditional E-value: 1.5e-22
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+ Id+iD ++++ l +Rm+++k++ ++K +n+ ++ peR++++l +++++aee+gld+ +ve +f +ii++ +a Q
VIMSS2195305 14 REAIDQIDLDIVQALGRRMDYVKAASRFK-ANEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQ 90
99***************************.5777*****************************************998 PP
Or compare VIMSS2195305 to CDD or PaperBLAST