VIMSS2195631 has 175 amino acids
Query: DUF4123 [M=123] Accession: PF13503.10 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-32 96.6 2.2 8.6e-32 96.2 2.2 1.2 1 VIMSS2195631 Domain annotation for each sequence (and alignments): >> VIMSS2195631 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.2 2.2 8.6e-32 8.6e-32 1 123 [] 17 144 .. 17 144 .. 0.95 Alignments for each domain: == domain 1 score: 96.2 bits; conditional E-value: 8.6e-32 DUF4123 1 lYaLlDgaadpellelleaesgeaase.LyagtpeeelaevgPwLveledasel....sallr.leeegwgpslglllaSaapleelarhLrsllqv 91 l+aL+Dga++ +l ++le+ +ge s+ L+ag++++e+a++gP+L+e +d ++l ++l + +++ + p++++ l+S+a++e la+h+ ll+ VIMSS2195631 17 LFALADGARYLTLDTRLEKAAGEISSRwLLAGSELDEIAHAGPVLIEFMDSAPLsssgEFLGWlRDWDRRSPMASW-LWSRASFENLAKHFAGLLFT 112 79*************************************************8888888555557789999******.******************** PP DUF4123 92 rlpdgeavllRfydprvlrallptldeeqrsa 123 r+pdg+++llR+y p+v ral ++++++q+++ VIMSS2195631 113 RMPDGRRALLRYYSPEVRRALEQVMTARQWTQ 144 *****************************986 PP
Or compare VIMSS2195631 to CDD or PaperBLAST