VIMSS219567 has 86 amino acids
Query: DUF1654 [M=70]
Accession: PF07867.15
Description: Protein of unknown function (DUF1654)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7e-37 111.4 0.0 8.2e-37 111.2 0.0 1.1 1 VIMSS219567
Domain annotation for each sequence (and alignments):
>> VIMSS219567
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 111.2 0.0 8.2e-37 8.2e-37 1 70 [] 16 85 .. 16 85 .. 0.98
Alignments for each domain:
== domain 1 score: 111.2 bits; conditional E-value: 8.2e-37
DUF1654 1 tsyerlgaRvqriinaPaaQksrvavvlrlegeseedWarlleelaeteevelafqdDgsvrvrWerple 70
ts+++l+aR+q+iin+PaaQk+rvav+++++ges+edW++l+e++++te+v+laf+dDg+vrv+We+ple
VIMSS219567 16 TSFDLLAARIQKIINSPAAQKNRVAVIYKAPGESQEDWGALVEAMEGTEGVSLAFEDDGGVRVTWEKPLE 85
79*****************************************************************976 PP
Or compare VIMSS219567 to CDD or PaperBLAST