VIMSS2196206 has 224 amino acids
Query: DUF3313 [M=186] Accession: PF11769.12 Description: Protein of unknown function (DUF3313) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-60 188.8 0.1 5.5e-60 188.6 0.1 1.0 1 VIMSS2196206 Domain annotation for each sequence (and alignments): >> VIMSS2196206 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 188.6 0.1 5.5e-60 5.5e-60 1 186 [] 28 212 .. 28 212 .. 0.99 Alignments for each domain: == domain 1 score: 188.6 bits; conditional E-value: 5.5e-60 DUF3313 1 kysgflsdYsgLkpesgakggavlryvdpgvdlakydkviiePvvlypgpdpeeklsaedlqllanyldraLkkeLskrfrlvaspgpgtLrvrlai 97 +ysgf++dYs L+p++ ++g+++lr+vdp++d+++y+ ++ieP+++yp p+p++k+sa++l+ +++y+d+aL++eL k +l+++pgpg L+++ ai VIMSS2196206 28 NYSGFIGDYSTLAPATAPSGAPLLRWVDPQADVRRYQRIYIEPSRFYPVPKPNDKVSAKTLADITTYYDQALRRELGKSLPLASAPGPGILVLKPAI 124 59*********************************************************************************************** PP DUF3313 98 TgvkpttpvlatlsvllPiglvvnlvqaatgertgvGslaveaeitDavtgellaaavdkragnkintsarvsklsdakaaidkwaddl 186 T+v++ t++l++++v+ Pi+l+++++++a+g+r++++++a+ea ++D+ ++++la++v++++g++++ s ++ + +d+ka++d wa+d+ VIMSS2196206 125 TAVSSHTQGLRPYEVI-PIALIAAGMSTAVGIRDQDTQIATEAMLLDGGDNKVLAKMVRQGTGKALDDSDQPITGDDVKAVLDGWAADM 212 ****************.*************************************************77******************996 PP
Or compare VIMSS2196206 to CDD or PaperBLAST