PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2197277 to PF07867 (DUF1654)

VIMSS2197277 has 80 amino acids

Query:       DUF1654  [M=70]
Accession:   PF07867.16
Description: Protein of unknown function (DUF1654)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      6e-36  108.4   0.1    6.7e-36  108.2   0.1    1.0  1  VIMSS2197277  


Domain annotation for each sequence (and alignments):
>> VIMSS2197277  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  108.2   0.1   6.7e-36   6.7e-36       1      67 [.      12      78 ..      12      80 .] 0.98

  Alignments for each domain:
  == domain 1  score: 108.2 bits;  conditional E-value: 6.7e-36
       DUF1654  1 tsyerlgaRvqriinaPaaQksrvavvlrlegeseedWarlleelaeteevelafqdDgsvrvrWer 67
                  t+y++l++R+qrii+aPaaQ++++a+++rl+ge+e+dWa+lle++++++++ l++q+Dgs+++rW++
  VIMSS2197277 12 TAYDLLNTRIQRIIHAPAAQQACQACISRLPGEDEGDWAHLLESFDRSNQWLLDPQRDGSIVLRWSS 78
                  79***************************************************************97 PP



Or compare VIMSS2197277 to CDD or PaperBLAST