VIMSS2198562 has 190 amino acids
Query: DUF4154 [M=143] Accession: PF13689.10 Description: YfiR/HmsC-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-37 113.6 0.0 5.1e-37 113.3 0.0 1.1 1 VIMSS2198562 Domain annotation for each sequence (and alignments): >> VIMSS2198562 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.3 0.0 5.1e-37 5.1e-37 4 143 .] 48 185 .. 45 185 .. 0.91 Alignments for each domain: == domain 1 score: 113.3 bits; conditional E-value: 5.1e-37 DUF4154 4 kaaflynfakfveWpaeafaselrlcvlgddpfasaleallagkkvggrpievrrlsdva.ea.eechvlyisrsearelaailaalkgkpvLtvsd 98 + ++l++++++v+Wp+e l+lcv+g++++a+ l + + + ++gr+++++r + + ++ + c+v+y++ ++re+++++ +l+g+pvL++s+ VIMSS2198562 48 VSQVLLGIFSYVRWPKEPAV--LQLCVVGPTEYADGLLRGMVQ--ANGRRVHAERRAVDNpDLgTLCNVIYLGVVDERERQQVFHSLAGHPVLSISE 140 56899**************9..*****************6665..566778777777777334678******************************* PP DUF4154 99 segfaesggminLvreddrlrfeiNldaarraglkisskLLrLAr 143 + ++++ g+m++L+ + r++fe Nld+++r+g+++++++L+LAr VIMSS2198562 141 RGTECSVGSMFCLNVGGPRITFEANLDSIARSGVRVHPSVLKLAR 185 ********************************************7 PP
Or compare VIMSS2198562 to CDD or PaperBLAST