VIMSS2199634 has 135 amino acids
Query: DUF4149 [M=102] Accession: PF13664.10 Description: Domain of unknown function (DUF4149) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-09 24.7 11.1 1.2e-09 24.7 11.1 2.0 2 VIMSS2199634 Domain annotation for each sequence (and alignments): >> VIMSS2199634 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.7 11.1 1.2e-09 1.2e-09 3 93 .. 12 104 .. 10 107 .. 0.85 2 ! 7.6 4.5 0.00025 0.00025 43 89 .. 82 124 .. 79 128 .. 0.83 Alignments for each domain: == domain 1 score: 24.7 bits; conditional E-value: 1.2e-09 DUF4149 3 lalllGsllfvtfvvapvlfka.LpraqfgalqsklFpvyfllglalavlllltellrg.sellaaae..kaqllllavmllltllnafvlePri 93 ++++G+l+ + fvv p l k+ L + +++++l p+ + ++avl +l+ + ++ + ++ ++ + qlll++++l+l+ + +l+P + VIMSS2199634 12 QTFWVGGLWLLQFVVLPALAKTgLAPLLVETVAAALTPLLIGFAGFCAVLQALVLVSSHgP--RSLWRdlRGQLLLAVALLCLVYFLVRGLAPEA 104 689*******************99***********************************53..44444348888888888888777777777765 PP == domain 2 score: 7.6 bits; conditional E-value: 0.00025 DUF4149 43 llglalavlllltellrgsellaaaekaqllllavmllltllnafvl 89 +l+la+a+l l+++l+rg l +a ++ l +++++++ll +vl VIMSS2199634 82 QLLLAVALLCLVYFLVRG--LAPEAVRWLLFNYLAVAMCGLL--LVL 124 6789999999*****998..6666669999999999999998..444 PP
Or compare VIMSS2199634 to CDD or PaperBLAST