VIMSS2200072 has 185 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-15 42.3 0.4 8.3e-15 41.3 0.4 1.5 1 VIMSS2200072 Domain annotation for each sequence (and alignments): >> VIMSS2200072 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.3 0.4 8.3e-15 8.3e-15 9 79 .] 31 101 .. 31 101 .. 0.97 Alignments for each domain: == domain 1 score: 41.3 bits; conditional E-value: 8.3e-15 CM_2 9 relleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 ++ll L ++R++la+++a+ K+++g++v d Ree++l+ l+ +a ++g+ +e v+ +f + i++ + +Q+ VIMSS2200072 31 QQLLSLSSQRLQLADQVAQSKAQSGKAVQDSPREEQQLQMLAGQAGSHGVGAEQVRLLFAAQIEANKLVQY 101 69***************************************************************999886 PP
Or compare VIMSS2200072 to CDD or PaperBLAST