VIMSS2200072 has 185 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-15 42.3 0.4 8.3e-15 41.3 0.4 1.5 1 VIMSS2200072
Domain annotation for each sequence (and alignments):
>> VIMSS2200072
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 41.3 0.4 8.3e-15 8.3e-15 9 79 .] 31 101 .. 31 101 .. 0.97
Alignments for each domain:
== domain 1 score: 41.3 bits; conditional E-value: 8.3e-15
CM_2 9 relleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
++ll L ++R++la+++a+ K+++g++v d Ree++l+ l+ +a ++g+ +e v+ +f + i++ + +Q+
VIMSS2200072 31 QQLLSLSSQRLQLADQVAQSKAQSGKAVQDSPREEQQLQMLAGQAGSHGVGAEQVRLLFAAQIEANKLVQY 101
69***************************************************************999886 PP
Or compare VIMSS2200072 to CDD or PaperBLAST