VIMSS2208226 has 48 amino acids
Query: DUF1127 [M=37] Accession: PF06568.16 Description: Domain of unknown function (DUF1127) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-21 61.4 0.4 3.8e-21 60.9 0.4 1.3 1 VIMSS2208226 Domain annotation for each sequence (and alignments): >> VIMSS2208226 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.9 0.4 3.8e-21 3.8e-21 1 37 [] 3 39 .. 3 39 .. 0.97 Alignments for each domain: == domain 1 score: 60.9 bits; conditional E-value: 3.8e-21 DUF1127 1 lraalrrWrryRrtrreLarLsDreLaDIGLsRsdir 37 +++ +++Wr yR+t++eL+r+s reL+D+G+ Rs+ir VIMSS2208226 3 VARSFNNWRKYRQTVAELGRMSARELDDLGIGRSEIR 39 6899********************************8 PP
Or compare VIMSS2208226 to CDD or PaperBLAST