VIMSS2208226 has 48 amino acids
Query: DUF1127 [M=37]
Accession: PF06568.16
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.6e-21 61.4 0.4 3.8e-21 60.9 0.4 1.3 1 VIMSS2208226
Domain annotation for each sequence (and alignments):
>> VIMSS2208226
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 60.9 0.4 3.8e-21 3.8e-21 1 37 [] 3 39 .. 3 39 .. 0.97
Alignments for each domain:
== domain 1 score: 60.9 bits; conditional E-value: 3.8e-21
DUF1127 1 lraalrrWrryRrtrreLarLsDreLaDIGLsRsdir 37
+++ +++Wr yR+t++eL+r+s reL+D+G+ Rs+ir
VIMSS2208226 3 VARSFNNWRKYRQTVAELGRMSARELDDLGIGRSEIR 39
6899********************************8 PP
Or compare VIMSS2208226 to CDD or PaperBLAST