VIMSS2229165 has 110 amino acids
Query: DUF732 [M=72]
Accession: PF05305.18
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-27 81.5 0.7 3.7e-27 81.0 0.5 1.4 1 VIMSS2229165
Domain annotation for each sequence (and alignments):
>> VIMSS2229165
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 81.0 0.5 3.7e-27 3.7e-27 2 72 .] 35 104 .. 31 104 .. 0.96
Alignments for each domain:
== domain 1 score: 81.0 bits; conditional E-value: 3.7e-27
DUF732 2 DdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCPq 72
D+ Fla++++ Gv++++p++a++ GhqvC++L+aGk+p++v+ a+ ++ ++lt+ qaa +v aA++ayCPq
VIMSS2229165 35 DEMFLAQMRSLGVSFPSPQEAVREGHQVCAELSAGKTPTAVTVAVFRQ-TNLTPPQAAGLVTAATQAYCPQ 104
667*********************************************.*********8888********8 PP
Or compare VIMSS2229165 to CDD or PaperBLAST