VIMSS2230658 has 111 amino acids
Query: DUF732 [M=72] Accession: PF05305.18 Description: Protein of unknown function (DUF732) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-26 77.2 1.1 5.4e-26 77.2 1.1 1.4 2 VIMSS2230658 Domain annotation for each sequence (and alignments): >> VIMSS2230658 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.7 0.1 0.46 0.46 57 68 .. 9 20 .. 7 21 .. 0.71 2 ! 77.2 1.1 5.4e-26 5.4e-26 1 72 [] 25 96 .. 25 96 .. 0.99 Alignments for each domain: == domain 1 score: -2.7 bits; conditional E-value: 0.46 DUF732 57 qaaffvgaAiaa 68 aa +vg Ai a VIMSS2230658 9 GAAALVGMAIPA 20 566888888865 PP == domain 2 score: 77.2 bits; conditional E-value: 5.4e-26 DUF732 1 aDdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCPq 72 +DdaFlaaL++aG+ty+dp++ai+aG+ vCd +G++ d+++++++ np +++++aa fv+aA+ ayCP+ VIMSS2230658 25 DDDAFLAALNKAGITYPDPTRAIRAGQKVCDLAGSGTTELDIIRDVHELNPAFSTAKAALFVQAAAGAYCPD 96 79*********************************************************************7 PP
Or compare VIMSS2230658 to CDD or PaperBLAST