VIMSS2231303 has 114 amino acids
Query: DUF732 [M=72]
Accession: PF05305.18
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-23 69.8 0.4 1.6e-23 69.3 0.4 1.2 1 VIMSS2231303
Domain annotation for each sequence (and alignments):
>> VIMSS2231303
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 69.3 0.4 1.6e-23 1.6e-23 1 72 [] 26 97 .. 26 97 .. 0.98
Alignments for each domain:
== domain 1 score: 69.3 bits; conditional E-value: 1.6e-23
DUF732 1 aDdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCPq 72
+D++Fl+ L++aG+ty+d+ +ai +G++vC+ Ld+G+s a ++++l+++np ++ + aa f +++a+yCP+
VIMSS2231303 26 NDQDFLKDLRDAGITYQDAGNAITIGKSVCELLDDGQSDAKIVTDLRNQNPAFQGASAAKFTYLSAAHYCPK 97
69*********************************************************9999********5 PP
Or compare VIMSS2231303 to CDD or PaperBLAST