VIMSS241680 has 208 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.8e-20 57.6 0.0 9.6e-20 56.6 0.0 1.5 1 VIMSS241680
Domain annotation for each sequence (and alignments):
>> VIMSS241680
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 56.6 0.0 9.6e-20 9.6e-20 1 55 [. 140 194 .. 140 195 .. 0.98
Alignments for each domain:
== domain 1 score: 56.6 bits; conditional E-value: 9.6e-20
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsG 55
+t+d+ +gklq+ L+++g ++d+ Y++ Vt++v +pe++v++f+++L+++t+G
VIMSS241680 140 VTVDHHRAGKLQNDLRTAGRAVRDVRYAEAVTIEVGLPEADVDTFRSWLADATAG 194
79****************************************************9 PP
Or compare VIMSS241680 to CDD or PaperBLAST