VIMSS242183 has 124 amino acids
Query: DUF485 [M=89]
Accession: PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-36 110.2 3.0 2.4e-36 110.0 3.0 1.0 1 VIMSS242183
Domain annotation for each sequence (and alignments):
>> VIMSS242183
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 110.0 3.0 2.4e-36 2.4e-36 1 88 [. 31 117 .. 31 118 .. 0.98
Alignments for each domain:
== domain 1 score: 110.0 bits; conditional E-value: 2.4e-36
DUF485 1 qaspkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeeir 88
q+s++F+eL+r++r+fafplt++f+++Y+l+vll+ +a ++++tk++ gni+v++++g++qfv+tf+++++Y+r+A ++Dp+ae+i+
VIMSS242183 31 QQSAEFAELRRSFRSFAFPLTVAFVAWYLLYVLLSNYAGGFMGTKLF-GNINVAFVFGIAQFVTTFLIAWWYSRHAAAKLDPKAEAIK 117
6899*******************************************.**************************************97 PP
Or compare VIMSS242183 to CDD or PaperBLAST