VIMSS245285 has 236 amino acids
Query: DUF402 [M=68]
Accession: PF04167.17
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-21 62.5 1.4 2.9e-21 61.8 1.4 1.4 1 VIMSS245285
Domain annotation for each sequence (and alignments):
>> VIMSS245285
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 61.8 1.4 2.9e-21 2.9e-21 4 68 .] 106 170 .. 103 170 .. 0.95
Alignments for each domain:
== domain 1 score: 61.8 bits; conditional E-value: 2.9e-21
DUF402 4 lwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68
l l ++ge+++v+ f+d+ +r+k+wYvn+++p r eg v+++D+ LD+ v+pd++++ DedE+
VIMSS245285 106 LKLARPGEAWSVWLFWDPGWRFKNWYVNLERPLTRWEGGVDSEDHFLDISVHPDRTWHWRDEDEF 170
77899***************************9996788*************************9 PP
Or compare VIMSS245285 to CDD or PaperBLAST