VIMSS2507792 has 286 amino acids
Query: DUF4123 [M=119] Accession: PF13503.11 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-25 75.0 0.0 7.8e-25 73.7 0.0 1.7 1 VIMSS2507792 Domain annotation for each sequence (and alignments): >> VIMSS2507792 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.7 0.0 7.8e-25 7.8e-25 1 118 [. 27 140 .. 27 141 .. 0.95 Alignments for each domain: == domain 1 score: 73.7 bits; conditional E-value: 7.8e-25 DUF4123 1 lYallDgaldpellellealsgeaaseLyagtpeeelaevgPwLveledasallreeegwgpslgwllaSalplealaahlrsllqvrlpdgeevll 97 +Y+l+D++ ++++++ + + + + +++g++++ +++ +PwLv+++d +++ + + ++g++l++++p +l hl+sll ++l +geevl+ VIMSS2507792 27 VYWLADHLTFKQAVANNSGIVFDGTQVVFHGETFAPVMALSPWLVPVSDMVSDI---DYECLQQGIFLSCSCPSTELLSHLQSLLIAAL-EGEEVLF 119 6***********************999***********************8877...7788889*************************.******* PP DUF4123 98 Rfydprvlrallqtldeeqrs 118 Rfyd +v+ ++l+ +de + + VIMSS2507792 120 RFYDRQVIVPMLERMDEIEKN 140 ****************99876 PP
Or compare VIMSS2507792 to CDD or PaperBLAST