PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS263336 to PF04167 (DUF402)

VIMSS263336 has 176 amino acids

Query:       DUF402  [M=68]
Accession:   PF04167.17
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.2e-23   69.4   5.3    1.2e-23   69.4   4.0    1.7  2  VIMSS263336  


Domain annotation for each sequence (and alignments):
>> VIMSS263336  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.0   0.0      0.46      0.46      12      21 ..      18      27 ..       5      31 .. 0.65
   2 !   69.4   4.0   1.2e-23   1.2e-23       2      68 .]      60     124 ..      59     124 .. 0.95

  Alignments for each domain:
  == domain 1  score: -3.0 bits;  conditional E-value: 0.46
       DUF402 12 wynvtkflde 21
                 + +++++++e
  VIMSS263336 18 NGSIHRMWKE 27
                 4466777765 PP

  == domain 2  score: 69.4 bits;  conditional E-value: 1.2e-23
       DUF402   2 lalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68 
                  +a+++++++ w+nv+ +l+e  +++++Y+n+++p  ++ +++kyiD++LD++vypd+++ +lDedE+
  VIMSS263336  60 PAICYFHENYWFNVIGMLRE--EGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEY 124
                  799****************9..9***********77766***************************7 PP



Or compare VIMSS263336 to CDD or PaperBLAST