VIMSS263336 has 176 amino acids
Query: DUF402 [M=68] Accession: PF04167.17 Description: Protein of unknown function (DUF402) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-23 69.4 5.3 1.2e-23 69.4 4.0 1.7 2 VIMSS263336 Domain annotation for each sequence (and alignments): >> VIMSS263336 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.46 0.46 12 21 .. 18 27 .. 5 31 .. 0.65 2 ! 69.4 4.0 1.2e-23 1.2e-23 2 68 .] 60 124 .. 59 124 .. 0.95 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.46 DUF402 12 wynvtkflde 21 + +++++++e VIMSS263336 18 NGSIHRMWKE 27 4466777765 PP == domain 2 score: 69.4 bits; conditional E-value: 1.2e-23 DUF402 2 lalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68 +a+++++++ w+nv+ +l+e +++++Y+n+++p ++ +++kyiD++LD++vypd+++ +lDedE+ VIMSS263336 60 PAICYFHENYWFNVIGMLRE--EGVYYYCNLSSPFAYDSEALKYIDYDLDIKVYPDMTYTLLDEDEY 124 799****************9..9***********77766***************************7 PP
Or compare VIMSS263336 to CDD or PaperBLAST