VIMSS265567 has 358 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-24 72.3 0.4 4.8e-24 70.9 0.4 1.8 1 VIMSS265567
Domain annotation for each sequence (and alignments):
>> VIMSS265567
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.9 0.4 4.8e-24 4.8e-24 1 79 [] 10 87 .. 10 87 .. 0.96
Alignments for each domain:
== domain 1 score: 70.9 bits; conditional E-value: 4.8e-24
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
Rk++dei+ +ll+Ll++R e++++i+e K+ +g + +dp Re+evl+ ++e+ e ++ ++v++if++i+++s++lQ+
VIMSS265567 10 RKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAENN-EGPFETSTVQHIFKTIFKASLELQE 87
9**************************************************43.566********************96 PP
Or compare VIMSS265567 to CDD or PaperBLAST