VIMSS269909 has 174 amino acids
Query: SocA_Panacea [M=114] Accession: PF13274.10 Description: Antitoxin SocA-like, Panacea domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-25 74.3 0.1 1.3e-24 73.7 0.1 1.3 1 VIMSS269909 Domain annotation for each sequence (and alignments): >> VIMSS269909 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.7 0.1 1.3e-24 1.3e-24 1 114 [] 26 139 .. 26 139 .. 0.97 Alignments for each domain: == domain 1 score: 73.7 bits; conditional E-value: 1.3e-24 SocA_Panacea 1 LqKllYladalslkkygkpltgdeyeawkyGPVvpevydeikgkkgkpieeseeefedeklekeekeeveeeeegeenelseeekeildeviekykd 97 LqKllY+++ + ++g pl+++++e+wkyGPVvp+vy+e+k +++ +i + e e +++ +++e ++ e+ e++ + e+ ++++ ++ ++ VIMSS269909 26 LQKLLYFVNVRNILENGAPLFEESMEKWKYGPVVPDVYHEYKRFGAFSISTDEMIMEYVEFSVSPFGELSDLEITEYDSQKVENTQLIENTVDALHG 122 9**********************************************9988888888889****************999****************** PP SocA_Panacea 98 lsakeLselthkekaWk 114 + ++eL+++th++++Wk VIMSS269909 123 FGPFELVDITHDHTPWK 139 ****************7 PP
Or compare VIMSS269909 to CDD or PaperBLAST