VIMSS270058 has 177 amino acids
Query: DUF402 [M=68]
Accession: PF04167.17
Description: Protein of unknown function (DUF402)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.1e-23 67.1 2.6 1.5e-22 65.9 2.6 1.7 1 VIMSS270058
Domain annotation for each sequence (and alignments):
>> VIMSS270058
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 65.9 2.6 1.5e-22 1.5e-22 2 68 .] 60 124 .. 59 124 .. 0.95
Alignments for each domain:
== domain 1 score: 65.9 bits; conditional E-value: 1.5e-22
DUF402 2 lalwllplgewynvtkfldedgrlkgwYvniatppergegtvkyiDlyLDvvvypdgevevlDedEL 68
+a+++++++ w+n+++++++ +++ +Y+n+a+p + +++kyiD++LDv+v++dge ++lD+dE+
VIMSS270058 60 PAIVYFHKKYWFNIIAMIRD--NGVSYYCNLASPYMMDTEALKYIDYDLDVKVFADGEKRLLDVDEY 124
799****************9..9***********77766***************************7 PP
Or compare VIMSS270058 to CDD or PaperBLAST