VIMSS27810 has 200 amino acids
Query: DUF1524 [M=139] Accession: PF07510.15 Description: Protein of unknown function (DUF1524) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-28 84.0 4.6 7.3e-28 83.4 4.6 1.3 1 VIMSS27810 Domain annotation for each sequence (and alignments): >> VIMSS27810 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.4 4.6 7.3e-28 7.3e-28 10 138 .. 46 171 .. 38 172 .. 0.84 Alignments for each domain: == domain 1 score: 83.4 bits; conditional E-value: 7.3e-28 DUF1524 10 dledkklyrssskklryilagrlesdlyeedesknsskkefdiEHilPqnlaekwgageddeekreelvndlgNLtlltgslNsslsnkdfleKreaye 108 ++++ ++++ k l y+l+ + e + + e+ + + ++e+ iEHilPq++++++ a+e++ k +v+ lgNL+l+ + +Nsslsnk+f+eKr++y VIMSS27810 46 SKKNTEKWYKWGKTLNYLLY-EYELYHNPETTLNFDGSIES-IEHILPQKPDQGYSAKEKNWAKNPHVVHALGNLLLIPKNANSSLSNKPFDEKRKEYL 142 5567777888888999****.77733333344444455666.*************9999999999999******************************8 PP DUF1524 109 ksclylnrklavkdkwneeviearqeaLak 138 k ++ ++++a+++++++++i++r+e+L++ VIMSS27810 143 KGSY-SEKEVAKNASFGITEIQKRSEKLLD 171 6665.9*********************985 PP
Or compare VIMSS27810 to CDD or PaperBLAST