VIMSS284024 has 169 amino acids
Query: DUF2628 [M=88]
Accession: PF10947.12
Description: Protein of unknown function (DUF2628)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-29 87.2 1.0 5.3e-29 86.8 1.0 1.2 1 VIMSS284024
Domain annotation for each sequence (and alignments):
>> VIMSS284024
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 86.8 1.0 5.3e-29 5.3e-29 8 88 .] 25 104 .. 11 104 .. 0.94
Alignments for each domain:
== domain 1 score: 86.8 bits; conditional E-value: 5.3e-29
DUF2628 8 lerfafvrdgfnfwAfffgpiwLlyrrlWlkalallvlavalevvlavlgvpdavrlvlnllvaillgleanslyylklsR 88
+e+++fvrdgf+++A++f+++wLl++rlW++a+a+l++++ l+++ ++lg++dav+l l++lv+++++le+++++++kl+R
VIMSS284024 25 SEKAVFVRDGFSILALVFPFVWLLMQRLWFEAFAVLGITILLGLAGTSLGIDDAVPL-LAILVSLFVALEGAGWKIAKLER 104
49******************************************************9.*********************98 PP
Or compare VIMSS284024 to CDD or PaperBLAST