PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS287215 to PF04363 (DUF496)

VIMSS287215 has 131 amino acids

Query:       DUF496  [M=93]
Accession:   PF04363.17
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-49  152.6   7.2    1.9e-49  152.1   7.2    1.2  1  VIMSS287215  


Domain annotation for each sequence (and alignments):
>> VIMSS287215  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  152.1   7.2   1.9e-49   1.9e-49       1      93 []      30     122 ..      30     122 .. 0.98

  Alignments for each domain:
  == domain 1  score: 152.1 bits;  conditional E-value: 1.9e-49
       DUF496   1 lnnvlelvrkarrknklkreiednekkirdnrkrvellenlleyikpnmsaeeikaiienmksdyedrvddyiiksaelskerrelskklkel 93 
                  +++vle+vr +rrknkl+rei+d+ekkirdn+krv ll+nl++yikp ms e i+ ii+ mk+dyedrvddyiik+aelskerr++skklk++
  VIMSS287215  30 FQDVLEFVRLFRRKNKLQREIQDVEKKIRDNQKRVLLLDNLSDYIKPGMSVEAIQGIIASMKGDYEDRVDDYIIKNAELSKERRDISKKLKAM 122
                  689***************************************************************************************976 PP



Or compare VIMSS287215 to CDD or PaperBLAST