VIMSS287917 has 76 amino acids
Query: DUF903 [M=49]
Accession: PF06004.16
Description: Bacterial protein of unknown function (DUF903)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-26 77.9 3.6 2.7e-26 77.6 3.6 1.1 1 VIMSS287917
Domain annotation for each sequence (and alignments):
>> VIMSS287917
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.6 3.6 2.7e-26 2.7e-26 1 49 [] 25 73 .. 25 73 .. 0.98
Alignments for each domain:
== domain 1 score: 77.6 bits; conditional E-value: 2.7e-26
DUF903 1 pyvitTkDGqtivtqgkPelDkdtGmyeYedeeGkevqInkddVkqIke 49
+yv++T+DG+tiv++gkP++D+d Gm++Y+d++G+++qIn+ dVk++ e
VIMSS287917 25 NYVMHTNDGRTIVSDGKPQTDNDIGMISYKDANGNKQQINRTDVKEMVE 73
7**********************************************87 PP
Or compare VIMSS287917 to CDD or PaperBLAST