VIMSS293163 has 182 amino acids
Query: DUF179 [M=157] Accession: PF02622.19 Description: Uncharacterized ACR, COG1678 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.5e-45 138.6 0.0 1.1e-44 138.4 0.0 1.0 1 VIMSS293163 Domain annotation for each sequence (and alignments): >> VIMSS293163 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 138.4 0.0 1.1e-44 1.1e-44 6 157 .] 19 166 .. 14 166 .. 0.94 Alignments for each domain: == domain 1 score: 138.4 bits; conditional E-value: 1.1e-44 DUF179 6 pnFersVvllcehneegamGlvlNrpleltlkelleelleleaepaaeepvylGGPveqdrlfvlhsle..lessleisdglyltgsldilealagga 101 ++F+r+V+l++eh+++ga+GlvlN++ e +++e+++ + + ++++ +y GGPv++ + vlh+ + + +ei +glyl s+d+l +l + VIMSS293163 19 DYFNRTVILMVEHDNQGAFGLVLNKRQEASIGEVIQGIPDHVSRNSL---IYSGGPVDPTFISVLHEDNkiSQPGIEIIPGLYLARSFDTLLEL--LK 111 79***********************************9999999888...*****************66788999*******************..79 PP DUF179 102 gpeklrvflGyagWgagQLeeEieenaWlvvpasdeellfetppeelWeealrrlG 157 +++k+ vf Gy+gWgagQLe E+++++W++ +a +++++++++pe+ W+ealr+ G VIMSS293163 112 SSSKFHVFQGYSGWGAGQLETEMNRKSWVIHEA-SKDFVLNQDPETTWQEALRSKG 166 99*******************************.666***************9876 PP
Or compare VIMSS293163 to CDD or PaperBLAST