VIMSS303120 has 45 amino acids
Query: DUF2770 [M=36]
Accession: PF10968.12
Description: Protein of unknown function (DUF2770)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.3e-23 66.3 13.5 1.2e-22 66.0 13.5 1.1 1 VIMSS303120
Domain annotation for each sequence (and alignments):
>> VIMSS303120
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.0 13.5 1.2e-22 1.2e-22 1 36 [] 10 44 .. 10 44 .. 0.98
Alignments for each domain:
== domain 1 score: 66.0 bits; conditional E-value: 1.2e-22
DUF2770 1 mRRlfhyLiNNiREHfMlYliLWsLLAimDlvyllf 36
mRRl +yLi NiREH+MlYl+LW+LLAimDl+y+++
VIMSS303120 10 MRRLVNYLI-NIREHLMLYLFLWGLLAIMDLIYVFY 44
9********.5************************9 PP
Or compare VIMSS303120 to CDD or PaperBLAST