VIMSS303233 has 77 amino acids
Query: DUF3950 [M=30]
Accession: PF13132.10
Description: Domain of unknown function (DUF3950)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-25 74.8 0.4 4e-25 73.8 0.4 1.5 1 VIMSS303233
Domain annotation for each sequence (and alignments):
>> VIMSS303233
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.8 0.4 4e-25 4e-25 1 30 [] 21 50 .. 21 50 .. 1.00
Alignments for each domain:
== domain 1 score: 73.8 bits; conditional E-value: 4e-25
DUF3950 1 mleQIeiaLekektsNFSAWVkEACRekLc 30
m+eQI+iaL +++++NFSAWV+EACR++Lc
VIMSS303233 21 MIEQINIALDQKGSGNFSAWVIEACRRRLC 50
9***************************** PP
Or compare VIMSS303233 to CDD or PaperBLAST