PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS319937 to PF06568 (DUF1127)

VIMSS319937 has 90 amino acids

Query:       DUF1127  [M=37]
Accession:   PF06568.15
Description: Domain of unknown function (DUF1127)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.9e-19   53.4   0.9    8.9e-19   53.4   0.9    1.7  2  VIMSS319937  


Domain annotation for each sequence (and alignments):
>> VIMSS319937  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.9   0.6      0.34      0.34       5      13 ..      30      38 ..      28      39 .. 0.48
   2 !   53.4   0.9   8.9e-19   8.9e-19       1      36 [.      45      80 ..      45      81 .. 0.95

  Alignments for each domain:
  == domain 1  score: -2.9 bits;  conditional E-value: 0.34
      DUF1127  5 lrrWrrrRr 13
                 +r+   +Rr
  VIMSS319937 30 ARAESNYRR 38
                 444445555 PP

  == domain 2  score: 53.4 bits;  conditional E-value: 8.9e-19
      DUF1127  1 lraalrrWrrrRrtrreLarLsDreLaDIGLsRsdi 36
                 l++ +++ r+++r ++eL++LsDreLaDIGL Rsdi
  VIMSS319937 45 LIRMIQAFRDYQRNVAELSQLSDRELADIGLDRSDI 80
                 67899******************************9 PP



Or compare VIMSS319937 to CDD or PaperBLAST