VIMSS323053 has 152 amino acids
Query: DUF3237 [M=149] Accession: PF11578.12 Description: Protein of unknown function (DUF3237) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-49 153.7 0.2 1.8e-49 153.5 0.2 1.0 1 VIMSS323053 Domain annotation for each sequence (and alignments): >> VIMSS323053 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 153.5 0.2 1.8e-49 1.8e-49 3 149 .] 7 151 .. 5 151 .. 0.97 Alignments for each domain: == domain 1 score: 153.5 bits; conditional E-value: 1.8e-49 DUF3237 3 lepaftlrvkldapievgegpegsrrivpitgGtvkgpklkgevlpgGaDwqtvdpdgtarldaryvlktddGaliyvrytGvltgppevlavlagge 100 ++++ft+++++++ ++ ge+ g rri+pi+gG+v+g ++ g+vlp+GaD+qt++p++ ++l+a+y ++t+dGa++yv+++G++ gp e l++l++ge VIMSS323053 7 TKYVFTITARIGDVVTAGETGIGVRRIIPIIGGEVTG-AVTGKVLPFGADFQTIRPNELIDLEAKYAFETADGAIVYVENKGIRFGPVELLQELKRGE 103 579*********88*****999***************.6*********************************************************** PP DUF3237 101 kvdsptdyyfrthprfetgdekykwLnrkvfvGsgrrrpdgveydvyrv 149 +vd p+ +yfrt+prfetg+eky+wL +++fv+s++r+ d+v++dv++v VIMSS323053 104 PVD-PKLIYFRTVPRFETGHEKYRWLMEHIFVASAARHADRVVIDVHQV 151 888.******************************************997 PP
Or compare VIMSS323053 to CDD or PaperBLAST