VIMSS325214 has 191 amino acids
Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-15 44.2 0.5 5.1e-14 38.8 0.0 2.2 2 VIMSS325214 Domain annotation for each sequence (and alignments): >> VIMSS325214 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.8 0.0 5.1e-14 5.1e-14 11 79 .] 39 107 .. 37 107 .. 0.94 2 ! 3.2 0.6 0.0066 0.0066 1 21 [. 131 151 .. 131 154 .. 0.89 Alignments for each domain: == domain 1 score: 38.8 bits; conditional E-value: 5.1e-14 CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79 ll aeR ++ +e+a K ++g+pvld +Re +vl+ +r++a +++ldp++++++f + i+ + +Q+ VIMSS325214 39 LLGKVAERNAIGDEVALSKWDTGKPVLDASRETAVLQSVRDQAPQYRLDPDLAARFFSAQIESNKLVQY 107 556679********************************************************9998885 PP == domain 2 score: 3.2 bits; conditional E-value: 0.0066 CM_2 1 RkeIdeiDrelleLlaeRmel 21 R+++d++ +ell+ la+ m l VIMSS325214 131 RDRLDHLQNELLDALAQSMTL 151 899*************98876 PP
Or compare VIMSS325214 to CDD or PaperBLAST