VIMSS326053 has 106 amino acids
Query: DUF485 [M=89]
Accession: PF04341.16
Description: Protein of unknown function, DUF485
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.5e-30 90.2 4.0 4e-30 90.0 4.0 1.0 1 VIMSS326053
Domain annotation for each sequence (and alignments):
>> VIMSS326053
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 90.0 4.0 4e-30 4e-30 2 89 .] 15 102 .. 14 102 .. 0.98
Alignments for each domain:
== domain 1 score: 90.0 bits; conditional E-value: 4e-30
DUF485 2 aspkFqeLvrkrrrfafpltaiflvvYflfvllvafapdllatkvvegnitvgillgllqfvltfvltglYvrrAnrefDplaeeire 89
a++k+++L+r+r+ +++ lt+++lvvYf+f+ l+af++++la ++++g++t gi+++++++++++++t++Yv ++n +D+l+++i+e
VIMSS326053 15 ANRKYHALKRQRNVLSWLLTLLMLVVYFGFIGLIAFNKAFLAVPLASGVTTRGIPIAIGVMLFAIIVTAVYVFFSNIVYDKLSRNILE 102
689*********************************************************************************9985 PP
Or compare VIMSS326053 to CDD or PaperBLAST