VIMSS33064 has 111 amino acids
Query: DUF732 [M=72]
Accession: PF05305.18
Description: Protein of unknown function (DUF732)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-24 71.7 4.4 4.9e-24 70.9 4.4 1.3 1 VIMSS33064
Domain annotation for each sequence (and alignments):
>> VIMSS33064
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.9 4.4 4.9e-24 4.9e-24 2 72 .] 37 106 .. 36 106 .. 0.98
Alignments for each domain:
== domain 1 score: 70.9 bits; conditional E-value: 4.9e-24
DUF732 2 DdaFlaaLdqaGvtytdpdaaiaaGhqvCdaLdaGkspadvaaallasnpgltadqaaffvgaAiaayCPq 72
D+aFla+L+++G+t +++++ai+ +h+vCdaLd+G s+++v++a++++ +gl+a+ a +f+ A++ayCPq
VIMSS33064 37 DEAFLAQLQADGITPPSAARAIKDAHAVCDALDEGHSAKAVIKAVAKA-TGLSAKGAKTFAVDAASAYCPQ 106
99**********************************************.*********9999********8 PP
Or compare VIMSS33064 to CDD or PaperBLAST